PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G1803
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SRS
Protein Properties Length: 314aa    MW: 34751.4 Da    PI: 8.3092
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G1803genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702222.49.3e-69862492154
       DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrel.............kskkqsal 86 
                  r+g+++CqdCGnqakkdCah RCRtCCksrgf+C+thvkstWvpaakrrerqqqlaa++++++++++++++++++e+              ++ + +l
  Gh_D05G1803  86 RQGGMNCQDCGNQAKKDCAHLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLAALQQTQQQQQQQQQQNQQQEHqqlfrgdnpkrqrDNHGSPSL 183
                  7899*****************************************************99988887755544444444456787777663223334455 PP

       DUF702  87 sstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                  ++t+ls +  ++ le  ++P+evss+avfrcv+vs++dd e e+aYqtav+i+GhvfkGiLyd+G+e+
  Gh_D05G1803 184 ACTRLSPT--TSGLELGQFPPEVSSPAVFRCVKVSAMDDVEGEFAYQTAVNIAGHVFKGILYDRGPES 249
                  55555555..45688889************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.0E-6589248IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.9E-2791133IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.1E-25199247IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAGFFYLGGR EGAASGKQEG ENKEENLYFY RNEEIYNKGF EIWPQYYYQQ QNVNNLSFGA  60
GPSRRTTGFN LSDESSSRSA GFTVMRQGGM NCQDCGNQAK KDCAHLRCRT CCKSRGFQCQ  120
THVKSTWVPA AKRRERQQQL AALQQTQQQQ QQQQQQNQQQ EHQQLFRGDN PKRQRDNHGS  180
PSLACTRLSP TTSGLELGQF PPEVSSPAVF RCVKVSAMDD VEGEFAYQTA VNIAGHVFKG  240
ILYDRGPESR YTSGGESSQQ LNLITTASTT AAAATTTTTA TSSDPGTSMI DPSLYPAPLN  300
AFIAGTQFFP PPRS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3942631e-101GQ394263.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS1228 SSR marker CGR6822 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448074.10.0PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9LQZ53e-99SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A0D2S4J40.0A0A0D2S4J4_G
STRINGPOPTR_0002s03000.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.11e-83SHI-related sequence 5